PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast09G135700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 550aa    MW: 61911 Da    PI: 7.0038
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast09G135700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM82.87.1e-263204491128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikev.diykvePwdLpkkvkaeekew..yfFskrdkkyatgkrknratksgyWkatgk 88 
                         l pGfrF Ptd+e+v++yLk kv +  l+  + ++e  ++y ++  ++p   ++++ke   +fF++++ k + ++    at +gyW+  g+
  Brast09G135700.1.p 320 LVPGFRFAPTDQEIVQHYLKLKVLNIALPRRHPVAEGhNVYALDADEIPLDGRNGDKERlgFFFARKEDKGTYSNGCYHATPEGYWRIRGR 410
                         579************************98877765555***********655566665557999999999888888888************ PP

                 NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                           +v + +g+++  k+ + fy+gr p+g +t W m ey+l
  Brast09G135700.1.p 411 PARVRQ-SGRTIAFKTPMDFYRGRPPHGCRTPWSMLEYAL 449
                         ****99.999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.75E-29318477IPR003441NAC domain
PROSITE profilePS5100532.686320478IPR003441NAC domain
PfamPF023653.9E-15322449IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 550 aa     Download sequence    Send to blast
MALNMFSNIS VAGPCWVVVD LPPLLRILLL LAEYLRRARR RGASCTRGRI LWRAKTESTA  60
DQSCRTACYC HRITSSVEAE DSTAGQNKEP CNFQRTMWTL GVAEEDGSRA SCHCHVTMLD  120
RLLPNIGGAF SEQRRQRRWS NCSWQENHVQ EKDDGSHDWS EQSCSGSIVD VSESQDVSCH  180
DQNSVCTSDA DSDAHCRTTL RAGTLTASTA WLKKYLPRPA DNNSTVAWSS RQLASSSSSS  240
DDDDMSSSIT ELDSSIAEQL DSNDDGDMDD CESVSCSTIT TEHELLLRQR DVGEDIAVSV  300
AREQTTTETT HNNGDTPWWL VPGFRFAPTD QEIVQHYLKL KVLNIALPRR HPVAEGHNVY  360
ALDADEIPLD GRNGDKERLG FFFARKEDKG TYSNGCYHAT PEGYWRIRGR PARVRQSGRT  420
IAFKTPMDFY RGRPPHGCRT PWSMLEYALN AADWRNDDLR NTTQPWMNSY VVCKVRKREH  480
QCVSDGRAEK FCRGLLPRRP FFKKVSPRSF RLEKVVDGAP PALKEEEAAT RQDGGETGVR  540
GKRVRPNMF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A8e-1632044915140Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLI1IZE30.0I1IZE3_BRADI; Uncharacterized protein
STRINGBRADI5G14950.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2924944
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04410.12e-20NAC domain containing protein 2